Viesearch
Viesearch - Human Powered Search Engine
594,213,423 Searches  3,389,404 Submissions  860,310 Sites  4,921 Featured  1,083 Categories  328,213 Editors
Recent Searches
Newest Featured
Roommates save, hosts earn. Make any city your home with our Instant Room Rentals!
As a leading web design agency in Guildford, we specialize in bespoke web design, web development, e-commerce solutions, and SEO optimisation, ensuring your online presence is as effective as possible. Whether you're a startup looking to establish a digital footprint or an established company aiming to revamp your online strategy, our Guildford based web agency is here to...
Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
Recent social activity
Sunday, June 9th, 2024 at 9:58am
Jack Rubin submitted a new listing for review
Sunday, June 9th, 2024 at 9:40am
Arccus Inc activated a new listing for How AI Can Improve Your Business
Sunday, June 9th, 2024 at 9:22am
fritz kailar submitted a new listing for review
Sunday, June 9th, 2024 at 9:12am
Recently Viewed Listings
MarineChamps - Yes you got it right ! We are marinechamps and we know how much it's difficult to find your aquarium needs in the era of pandemic. But we are here now. Sit back and relax! Just order your needs and we will deliver to your doorstepWhat is website? Different types of websites.... - A WEBSITE is a collection of web pages and related content that is identified by a common domain name and published on at least one web serverCNC Property Valuations & Appraisal Dubai - CNC Valuations is Leading Valuation and Property Advisory Company in Dubai. We Offer Valuation for all aspects of commercial and residential sites - including hotels,  plant and machinery sites,  hotels,  operating business,  floating docks and more Hire the Best Valuation Company to Make Well-Informed Real Estate,  Business and Hospitality Decisions that Will Benefit in the Long Run. CNC Valuations is the First Choice Valuation Service Provider in Dubai. We are registered and regulated by the RPersian Art House - Check out our arts and crafts selection for the very best in unique or custom, handmade pieces from our shops. You can buy Persian art & craft supplies via our online shop. We provide best quality Termeh, Khatam Kari, Mina Kari, Backgammon, Firoozeh Koobi, Ghalam Kari and Miniature products.Lab der Music - Unleash your musical potential with Lab der Musik, the leading music school in Berlin. Tailored lessons for every skill level and passion.
Trusted Web Directory - BananaDirectories.com is the best source for free website url submission to multiple search engines. We provide web site owners and webmasters to post websites to free internet search engines and directories. Facility to submit website URL to 100+ directories and top search engines. Its easy to increase your website traffic with our autmated website submission tool. Create your free search engine friendly Business DirectoryHGS Fidelity Mortgage Company - Financial Services in Baton Rouge, LA 
Address  : 4111 South Sherwood Forest Boulevard, Suite 2C, Baton Rouge, LA 70816, USA
 || Phone  : 225-223-6225endoscopy - Do you want to perform an endoscopy or colonoscopy study in Guadalajara? Make your Appointment today at Endoskopie! We have a service of Minimally Invasive Surgery, Colonoscopy, digestive and therapeutic endoscopy, as well as gastroenterology consultation and assessment. We will wait for you!Europe Tour Packages | Europe Dmc In India | Europe Group Tours - Book Europe Group Tours, Europe Tour Packages For Family, Europe Holiday Packages 2020 and Senior Citizen Tours from Delhi at very affordable prices.Industrial Outlook of Mobile Food Services Market - The global mobile food service market is projected to grow at a CAGR of 11.76% to reach a market size of US$5.483 billion in 2024, from US$2.814 billion in 2018. The mobile food services market is expected to have a significant growth rate driven by increasing demand for convenience food.
Recently Active Editors
shahzaadkambohfamilyfirstimdavidprincetechnicalsewaseobash
sgholidaystourfritkailarsouthbaymedsparazacompanyeconstruction
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!