Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
594,297,440 Searches  3,389,438 Submissions  860,312 Sites  4,920 Featured  1,083 Categories  328,224 Editors
Arts and Entertainment (79,269)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,365)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,327)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,447)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,414)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,491)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,066)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,264)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,615)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,042)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,175)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,306)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,596)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,010)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,375)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,675)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,765)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,110)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
Kenya Tanzania Safaris - Easy Budget Safaris Ltd offers Kenya Tanzania Safaris, Kenya Private Safaris, Kenya Budget Safaris, Kenya Lodge Safaris, Tanzania private safaris, Tanzania group joining safaris, Unforgettable Tanzania Safaris, Tanzania shared safaris, Mountaineering, Mt. Kilimanjaro climbing and Mount Kenya Hiking.
Kenya Tanzania Safaris
Easy Budget Safaris Ltd offers Kenya Tanzania Safaris, Kenya Private Safaris, Kenya Budget Safaris, Kenya Lodge Safaris, Tanzania private safaris, Tanzania group joining safaris, Unforgettable Tanzania Safaris, Tanzania shared safaris, Mountaineering, Mt. Kilimanjaro climbing and Mount Kenya Hiking.
https://www.easybudgetsafaris.com/ Travel, Tours - More Details
iROOMit Roommate finder & Rooms for rent - Roommates save, hosts earn. Make any city your home with our Instant Room Rentals!
iROOMit Roommate finder & Rooms for rent
Roommates save, hosts earn. Make any city your home with our Instant Room Rentals!
https://www.iroomit.com/ Home, Apartment Living - More Details
Web design agency Guildford, Surrey - As a leading web design agency in Guildford, we specialize in bespoke web design, web development, e-commerce solutions, and SEO optimisation, ensuring your online presence is as effective as possible. Whether you're a startup looking to establish a digital footprint or an established company aiming to revamp your online strategy, our Guildford based web agency is here to help you achieve your goals.
Web design agency Guildford, Surrey
As a leading web design agency in Guildford, we specialize in bespoke web design, web development, e-commerce solutions, and SEO optimisation, ensuring your online presence is as effective as possible. Whether you're a startup looking to establish a digital footprint or an established company aiming to revamp your online strategy, our Guildford based web agency is here to...
https://www.lightflows.co.uk Marketing and Advertising, Agencies - More Details
My Kitchen and Bath - Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
My Kitchen and Bath
Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
https://mykitchenandbath.com/ Home, Kitchen - More Details
Salesforce training institute in Pune - CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
Salesforce training institute in Pune
CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
https://www.crsinfosolutions.com/salesforce-training-cost-in-pune/ Reference and Education, Education and Training - More Details
Recent social activity
View more
Shahenaz activated a new listing for Upgrade Your Dining Experience: Premium Table Covers...
Sunday, June 9th, 2024 at 9:35pm
Tribe Home Buyers activated a new listing for Sell Your House Fast In Portsmouth, Virginia | We Buy...
Sunday, June 9th, 2024 at 8:22pm
Calligaris Westchester activated a new listing for Calligaris Round Glass Dining Table
Sunday, June 9th, 2024 at 7:27pm
daffodil software activated a new listing for Healthcare Software Testing
Sunday, June 9th, 2024 at 6:25pm
Asar activated a new listing and tagged "Heathrow Taxi"
heathrow taxis quotestaxi to luton airportairport transfer from heathrowhitchin taxistansted airport drop offairport taxi londonluton airport transfersairport taxi servicetaxi to airportluton airport taxi
Sunday, June 9th, 2024 at 5:52pm
Recently Viewed Listings
Farezhub - Farezhub is an online travel agency providing cheap flight bookings, changes, and cancellation support to the citizens of the USA and Canada. Get Flat $20 Off On Domestic Flights And Up to $400 Off On International Flight Tickets. Call Us Free Now @ +1-571-989-4175Rockingham Water Bores - Welcome to Rockingham Water Bores - your trusted experts in water bore drilling installation, maintenance, and repair. Our licensed contractors provide top-notch quality work for projects of all sizes. With over two decades of experience, we specialize in serving in Rockingham and across Perth.Radio Spots - Radio Commercial-Radio Spots For FREE Learn about the good and amazing services and products provided by SECA Funding CompanyExplainer Video Services at Affordable Prices - We caters to various multimedia platforms like Branding, Web design, E-learning solutions, Architecture design, Voice, music, Video Animation, Artworks, 3D/2D design. Indizine guarantees the most desired and captivating outcomes.Shudh Shilajit - We (OSR Ayurveda) are dealing in Shilajit Resin, Shudh Shilajit, Natural Shilajit, Shilajit Capsules, Shilajit Tablets & Shilajit Powder in bulk quantity at best price get more information so please contact hare
Commercial Spray Foam Insulation - Icynene is the preferred choice when it comes to commercial spray foam insulation, agricultural and residential projects. This unique spray foam insulation is 100% water blown and meets all of your needs from important condensation issues to insulation values.Viewpoint PMS - A cloud PMS with revenue management, rental distribution, exchange integration, resort booking website, owners portal , PCI certified payment processing and Owners Travel Club rewards program from Panorama Travel Solutions. Free demo available. Low cost Software as a Service1 BHK Flat In Greater Noida West - Are you thinking to buy 1 BHK Flat in Greater Noida West or Noida Extension? The Digital Diva - Social media agency providing strategy, training and full account managementMatte Brass Curved Square Pulls | Decorative Dresser Cabinet Pulls | Kitchen Cabinet Hardware - Italian-European Design Matte Brass Curved Square Pull updates your cabinets, doors and drawers with a sleek, elegant design. this cabinet door pulls offers a simple grip when accessing your cabinet interiors. Work great as drawer pulls and door handles for your kitchen or bathroom cabinets, or quickly and easily dress up your old dresser or furniture.
Recently Active Editors
demonsbehindmeeconstructionimdavidprinceawakenyshriganesh
softwareaspektecommercialnlegalcyghasumisadora_finch
Random Editor

Planse Colorat
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS