Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
593,915,255 Searches  3,389,092 Submissions  860,253 Sites  4,919 Featured  1,083 Categories  328,118 Editors
Arts and Entertainment (79,267)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,355)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,317)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,449)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,408)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,482)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,065)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,264)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,614)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,051)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,174)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,284)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,597)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,008)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,371)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,677)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,767)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,103)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
My Kitchen and Bath - Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
My Kitchen and Bath
Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
https://mykitchenandbath.com/ Home, Kitchen - More Details
Salesforce training institute in Pune - CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
Salesforce training institute in Pune
CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
https://www.crsinfosolutions.com/salesforce-training-cost-in-pune/ Reference and Education, Education and Training - More Details
Ripley Hypnotherapy Derbyshire office - Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
Ripley Hypnotherapy Derbyshire office
Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
http://ripley-hypnotherapy.co.uk Health and Fitness, Alternative - More Details
US License Plate Lookup - Guaranteed License Plate Search - Look up license plate for vehicle owner. Our license plate lookup service is guaranteed to provide vehicle owner name and address, or receive a full refund.
US License Plate Lookup - Guaranteed License Plate Search
Look up license plate for vehicle owner. Our license plate lookup service is guaranteed to provide vehicle owner name and address, or receive a full refund.
https://uslicenseplatelookup.com Business, Information Services - More Details
Cosmoso.shop - Online shop with low cost products and free fast shipping
Cosmoso.shop
Online shop with low cost products and free fast shipping
https://cosmoso.shop Shopping, Clothing and Shoes - More Details
Recent social activity
View more
Lyrix Danarius activated a new listing and submitted a new listing for review
Friday, June 7th, 2024 at 10:31pm
Anirvana Clinic edited, activated a new listing, and submitted a new listing for review
Friday, June 7th, 2024 at 10:24pm
DealFind activated a new listing and tagged Transporters Faridabad to Kolkata | Find @9667018580
goods transport faridabad to kolkatalocal transportation faridabad to kolkatasurface transport companies faridabad to kolkataroad transport services faridabad to kolkatafaridabad to kolkata transporterstransporter services faridabad to kolkatatransporters company faridabad to kolkatatransporters faridabad to kolkatatransport
Friday, June 7th, 2024 at 10:12pm
D'Art Design activated a new listing, submitted a new listing for review, and tagged Brand Identity Design Agency
retail identity servicesbrand identity designbrand identityvisual identity designbrand visual identitybrand identity agency
Friday, June 7th, 2024 at 10:06pm
iBrandox Online Pvt. Ltd. activated a new listing, submitted a new listing for review, and tagged Healthcare Digital Marketing Services in Delhi, Gurgaon:...
healthcare marketing companyhealthcare marketing companyhealthcare digital marketing agencyhealthcare seo marketing serviceshealthcare digital marketing companyhealthcare digital marketinghealthcare digital marketing solutionshealthcare digital marketing serviceshealthcare digital marketing agency
Friday, June 7th, 2024 at 9:58pm
Recently Viewed Listings
VetTrust Singapore - A Consulting and Solutions Service Provider for the Veterinary, Livestock and Pet Industry in Singapore and the Asia-Pacific RegionHire Dedicated Developers - Hire Dedicate Developer Form Dev Technosys UAE for $15 per hour, Dev Technosys has 10 years of experience in development.North india wildlife tour - Offers - India Tour Packages, Trip To India, Hotels In India, Travel To India, India car Rental, Travel Agent In India services at optimum price.Free Truck Removals in Melbourne - Sell Your Trucks - Sell Your Trucks is a well known Cash For Trucks in Melbourne. We buy trucks at any condition no matter the make or models. We offer Free Truck Removals in Melbourne. The best thing about our Truck removal service is that it takes about 30 minutes for us to remove trucks from your location. And for many reasons like these, we are the expert Truck Removals in Melbourne. For more details, call 0410 726 726.Oxygen/Ozone Therapy in Austin - Oxygen - Ozone Therapy Austin, Dental Ozone Therapy Austin, Ozone Therapy in Dentistry Austin TX, Austin Oxygen - Ozone Therapy: Dr Cole has extensive knowledge of ozone therapy and it's benefits for dental care.
Gas (oil) Fired Boiler,industrial Boiler,boiler Manufacturer - Our mainly pocessing equipment are coal fired, biomass fired, gas / oil fired and other types of steam boilers, hot water boiler, thermal fluid heaters etc. Our products are widely used in various processing industries and commercial services.Gyaap - We provide free maintenance to physical advertisement. We also provide decorative designs to attract real customers.TheRoyal - The luxury, private hideaway in M�hlbach am Hochk�nig. Luxurious retreat with that little bit more. Alpine enjoyment of the superlativeConstruction Material Price in Lahore - Maymaar Construction Material gives the best Construction Material Prices in Lahore and it has been set up and begun with protection from change and simplify a for the most part irrational and irksome market inside the advancement business and give the workplace to Buy Construction Material Online.enclavegarnet - A creative duo of photography professionals and audiovisual services. Create videos and digital content with us!
Recently Active Editors
ladiessalonbigapplemovingrugcleaningaunjfactorbookemily890
lowticketssamarnathanphysicianslossclinchsoftelitedigi
Random Editor

umamageshwari
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS