Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
593,729,426 Searches  3,388,654 Submissions  860,214 Sites  4,918 Featured  1,083 Categories  327,943 Editors
Arts and Entertainment (79,269)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,350)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,312)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,450)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,405)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,462)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,065)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,264)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,616)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,058)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,174)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,270)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,597)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,005)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,369)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,679)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,769)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,100)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
Salesforce training institute in Pune - CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
Salesforce training institute in Pune
CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
https://www.crsinfosolutions.com/salesforce-training-cost-in-pune/ Reference and Education, Education and Training - More Details
Ripley Hypnotherapy Derbyshire office - Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
Ripley Hypnotherapy Derbyshire office
Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
http://ripley-hypnotherapy.co.uk Health and Fitness, Alternative - More Details
US License Plate Lookup - Guaranteed License Plate Search - Look up license plate for vehicle owner. Our license plate lookup service is guaranteed to provide vehicle owner name and address, or receive a full refund.
US License Plate Lookup - Guaranteed License Plate Search
Look up license plate for vehicle owner. Our license plate lookup service is guaranteed to provide vehicle owner name and address, or receive a full refund.
https://uslicenseplatelookup.com Business, Information Services - More Details
Cosmoso.shop - Online shop with low cost products and free fast shipping
Cosmoso.shop
Online shop with low cost products and free fast shipping
https://cosmoso.shop Shopping, Clothing and Shoes - More Details
Dr B The Cosmetic Clinic - Dr B the Cosmetic Clinic deliver advanced cosmetic treatments, we specialise in nonsurgical medical procedures to enhance and rejuvenate the face. 
Dr B The Cosmetic Clinic
Dr B the Cosmetic Clinic deliver advanced cosmetic treatments, we specialise in nonsurgical medical procedures to enhance and rejuvenate the face. 
https://drbthecosmeticclinic.co.uk Health and Fitness, Cosmetic Surgery - More Details
Recent social activity
View more
Stephen Comite activated a new listing and submitted a new listing for review
Thursday, June 6th, 2024 at 6:55pm
sehaaonline activated a new listing and submitted a new listing for review
Thursday, June 6th, 2024 at 6:54pm
Bhansali Techno Components activated a new listing and submitted a new listing for review
Thursday, June 6th, 2024 at 6:13pm
ahadraza activated a new listing for Raised Floor Installation
Thursday, June 6th, 2024 at 5:32pm
Avina activated a new listing, submitted a new listing for review, and tagged sap fico training in hyderabad
online sap fico training in hyderabadsap fico training with job guaranteesap fico online training classes in hyderabadbest sap fico training in hyderabadsap fico online training and certification course
Thursday, June 6th, 2024 at 5:10pm
Recently Viewed Listings
Amare Stories - Amare stories are an award-winning wedding videography studio. They are based in Dublin, Ireland but ready to travel to wherever your wedding may be. Get in touch today.LG refrigerator repair center In Hyderabad - This is an extremely regular issue and a moderately straightforward fix! With the goal for ice to tumble from your ice distributor, it should have the option to open and close. This \The ancient & unique Matsya Festival to honor forefathers of Rajasthan - The Matsya Festival is a unique amongst the most eminent and important occassions of Rajasthan, held in Alwar. The multi day is observed in the long stretch of December continously and is known for displaying the rich social legacy of the area. The Matsya Festival is gone to by a great many individuals including local people, national and global travelers who find themselves connected in an variety of rivalries, displays, sports, customary tunes and moves, society music and the sky is the limit Get the best hibiscus tea in India-junglesting - Discover the unparalleled allure of JungleSting's finest hibiscus tea in India. Embark on a journey of flavor that captures the essence of lush Indian jungles and the vibrant spirit of hibiscus blooms. Sourced from the most pristine landscapes, our hibiscus tea carries a deep, ruby-red hue that mirrors the enchanting sunsets of the region. Burger Franchise Cost In India - Jumboking - To get detailed information about burger franchising costs in India, visit the Jumboking website or Contact us at (022) – 2927 1286
Remus Haste & Associates CPAs - Address: 41990 Cook Street, Bldg C, Suite 301, Palm Desert, CA 92211, USA || Phone: 760-360-2069Otolaryngology Medical Billing Services - Outsource your Medical Billing services for Otolaryngology medical practice. Boost your collections by using our Otolaryngology medical billing services. Hire Dot Net Developer - Keene Systems, Inc. offers unmatched expertise in .NET application development, providing specialized Microsoft .NET development services. Hire their skilled Dot Net developers to unleash the full potential of your projects. 100% Automated Income System - Imagine the life you want or start living the life you want the choice is yours. You decide This system is a done-for-you model. All you have to do is advertise your affiliate link and let the system do the rest. Not like other affiliate marketing programs that involve setting up all your links and funnels and then trying to keep track of everything yourself. Other people close the sales for you and send you a check for high-ticket online business education products.Industrial Products - Prismecs is global supplier of Industrial Products and industrial engineering services such as project management, engineering consulting, supply chain consulting, and system engineering.
Recently Active Editors
ascendhiringbashyamgraphicslilyevakfintechhaydenlee
youngbloodwcsnikunjmansoor895onthegoheadlands
Random Editor

Eworld life
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS