Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
594,014,077 Searches  3,389,289 Submissions  860,285 Sites  4,921 Featured  1,083 Categories  328,177 Editors
Arts and Entertainment (79,267)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,357)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,323)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,448)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,412)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,489)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,065)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,264)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,616)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,048)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,173)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,294)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,596)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,008)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,378)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,675)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,767)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,105)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
iROOMit Roommate finder & Rooms for rent - Roommates save, hosts earn. Make any city your home with our Instant Room Rentals!
iROOMit Roommate finder & Rooms for rent
Roommates save, hosts earn. Make any city your home with our Instant Room Rentals!
https://www.iroomit.com/ Home, Apartment Living - More Details
Web design agency Guildford, Surrey - As a leading web design agency in Guildford, we specialize in bespoke web design, web development, e-commerce solutions, and SEO optimisation, ensuring your online presence is as effective as possible. Whether you're a startup looking to establish a digital footprint or an established company aiming to revamp your online strategy, our Guildford based web agency is here to help you achieve your goals.
Web design agency Guildford, Surrey
As a leading web design agency in Guildford, we specialize in bespoke web design, web development, e-commerce solutions, and SEO optimisation, ensuring your online presence is as effective as possible. Whether you're a startup looking to establish a digital footprint or an established company aiming to revamp your online strategy, our Guildford based web agency is here to...
https://www.lightflows.co.uk Marketing and Advertising, Agencies - More Details
My Kitchen and Bath - Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
My Kitchen and Bath
Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
https://mykitchenandbath.com/ Home, Kitchen - More Details
Salesforce training institute in Pune - CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
Salesforce training institute in Pune
CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
https://www.crsinfosolutions.com/salesforce-training-cost-in-pune/ Reference and Education, Education and Training - More Details
Ripley Hypnotherapy Derbyshire office - Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
Ripley Hypnotherapy Derbyshire office
Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
http://ripley-hypnotherapy.co.uk Health and Fitness, Alternative - More Details
Recent social activity
View more
Kanika Gupta activated a new listing for Top Fantasy Cricket App Development Company
Saturday, June 8th, 2024 at 10:36am
Oris Dental activated a new listing for Why does the blood in spit up happen?
Saturday, June 8th, 2024 at 10:20am
Tetrahedron activated a new listing and tagged Lean Manufacturing Consultants
lean manufacturing consultantlean management consultantlean consultantlean consulting firmlean manufacturing consultants in indialean manufacturing consulting
Saturday, June 8th, 2024 at 10:01am
Nidhi Shah activated a new listing, submitted a new listing for review, and tagged Fathers Day Flowers Delivery Online | Order Fathers Day...
fathers day flowers delivery indiasend fathers day flowers to indiaorder fathers day flowers deliverybuy fathers day flowers online
Saturday, June 8th, 2024 at 9:44am
elianadavis activated a new listing and submitted a new listing for review
Saturday, June 8th, 2024 at 9:23am
Recently Viewed Listings
Bridalfeel - Bridalfeel Provide Pretty Formal Dresses Nz: Wedding Dresses, Bridesmaid Dresses, Ball Prom Dreses, Flower Girl Dress online at reasonable prices. Fast delivery to All Over New Zealand.Architects Raipur - What you must do is search for a company that targets office interior design. You ought to know upfront that we now have a best interior designer in Raipur.Financial & Economic Advisory Services - QuantEco offer strategic financial & economic advisory services. Our dedicated team of economists & analysts provides economic research to minimize risks and maximize opportunitiesBest Animation & MultiMediatraining Institute in Noida call: +91-8506-888-288 - The Techavera is the largest flourishing animation & multimedia coching institute in Noida with the hi-tech infrastructure and well-facilitated laboratory. We, at the techavera, have deep industry-leading commitment to understanding the training, development or recruitment services and to developing the corporate skills to the greater extent.Builder & Real Estate Developer in Ahmedabad Gujarat - Arise Group is a well known builder in Ahmedabad, engaged in developing various residential projects at sola road, gota & S G highway in Ahmedabad.
Structural 3D BIM Drawings - Building Information Modelling - Structural 3D BIM drawings are 3D models that show the physical structure of a building. This includes the structure of the building's walls, columns, beams, foundations, and other structural elements.Packers Movers Sector 95 | Noida Get Charges @9990847120 - Our Comapny there are no hidden fees. Customers benefit from the amount of care and attention to detail provided by Packers and Movers Sector 95 Noida, which ensures a safe, economical, and stress-free move. MOVERS PACKERS SECTOR 95 NOIDA | SAFE & SECURE We Packers and Movers Noida Sector 95 believe in safe and trouble free home and office shifting services so that our valuable customers get their loving goods as it is at their new destination. to get the free estimate on...T-140 Pressure Calibrator | techniCAL - Shop T-140 Pressure Calibrator from techniCAL - Top Online Calibrator seller in Toronto, Canada.beauty parlour classes in Btm layout - If you are someone who aspires to excell in the field of grooming, beauty and styling, then look no further as Classes Nearby offers courses in cosmetology, professional hairdressing, professional makeup, Beauty culture, Air brush makeup and more with placement guidance.Software development company|Website designing in jamshedpur - CommixtureSoft is a professional IT company providing web design, web development, web hosting and search engine optimization solutions in Jamshedpur.
Recently Active Editors
cresirenderingsnacktimewfecityraviharodmimosajungl
copyeditingmmtrekdrsohailalexon008solarindia
Random Editor

Ravi
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS