Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
590,928,599 Searches  3,384,208 Submissions  860,280 Sites  4,908 Featured  1,083 Categories  326,381 Editors
Arts and Entertainment (79,322)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,297)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,306)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,467)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,376)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,395)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,062)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,268)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,608)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,114)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,390)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,135)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,600)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (8,999)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,384)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,719)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,776)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,062)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
KOR Results - Based in San Francisco, California, KOR Results is a mental health practice specializing in treating OCD (Obsessive Compulsive Disorder) & other forms of anxiety. We work with you to understand who you are, how your OCD manifests in a day-to-day basis, and to create an individualized plan to break free from OCD and anxietys clutches. We strive to deliver our high-standard of mental health care to help you live life without OCDs permission.
KOR Results
Based in San Francisco, California, KOR Results is a mental health practice specializing in treating OCD (Obsessive Compulsive Disorder) & other forms of anxiety. We work with you to understand who you are, how your OCD manifests in a day-to-day basis, and to create an individualized plan to break free from OCD and anxietys clutches. We strive to deliver our...
https://www.korresults.com/ Health and Fitness, Mental Health - More Details
The Pagan Preacher - The Pagan Preacher is probably not what you are thinking. I am the host Richard Ravenbrook. A man, a life coach and spiritual mentor who has endeavered to find real spiritual truth and self enlightenment.
The Pagan Preacher
The Pagan Preacher is probably not what you are thinking. I am the host Richard Ravenbrook. A man, a life coach and spiritual mentor who has endeavered to find real spiritual truth and self enlightenment.
https://www.thepaganpreacher.com Computers and Internet, Podcasts - More Details
Projektowanie, tworzenie sklepów internetowych | Design Cart - Polish company that creates advanced online stores in responsive technology.
Projektowanie, tworzenie sklepów internetowych | Design...
Polish company that creates advanced online stores in responsive technology.
https://www.designcart.pl/ Computers and Internet, Web Design and Development - More Details
Commercial property maintenance, Repairs - City Wide Property Services, established in 2000, ensures the smooth operation of commercial properties across the Western US California, Washington, Oregon, Nevada, Arizona, and Texas. They provide a comprehensive suite of services for property managers, facility managers, and property owners, including steam and power washing, janitorial, day porter, landscape maintenance and enhancement, road, garage, and parking lot sweeping, illegal dump hauling, graffiti removal, and general...
Commercial property maintenance, Repairs
City Wide Property Services, established in 2000, ensures the smooth operation of commercial properties across the Western US California, Washington, Oregon, Nevada, Arizona, and Texas. They provide a comprehensive suite of services for property managers, facility managers, and property owners, including steam and power washing, janitorial, day porter, landscape maintenance...
https://www.citywideps.com Home, Domestic Services - More Details
Devops Consulting Services Company - Stackoversrive is a leading provider of cloud, AWS, and DevOps consulting services. We help businesses with their DevOps implementation and Kubernetes.
Devops Consulting Services Company
Stackoversrive is a leading provider of cloud, AWS, and DevOps consulting services. We help businesses with their DevOps implementation and Kubernetes.
https://www.stackoverdrive.com/devops-consulting-services Computers and Internet, Programming - More Details
Recent social activity
View more
sunrise oncology centers joined the team as a Viesearch editor!
Sunrise Oncology Centre offers cancer care with experts from Tata Memorial Hospital. Services include chemotherapy, immunotherapy, and comprehensive support.
Saturday, May 25th, 2024 at 6:25am
Davies Parker activated a new listing and submitted a new listing for review
Saturday, May 25th, 2024 at 6:18am
homeappliances submitted a new listing for review
Saturday, May 25th, 2024 at 6:11am
Raju Snghvi submitted a new listing for review
Saturday, May 25th, 2024 at 5:59am
Raju Snghvi joined the team as a Viesearch editor and claimed 11 listings!
Universe Metal & Alloy stands tall as a premier hub for the Manufacturers and Suppliers of Threaded Flanges, showcasing unparalleled excellence in crafting top-tier stainless steel components.
Saturday, May 25th, 2024 at 5:59am
Recently Viewed Listings
Unveiling Mystical Mustang: An Upper Mustang Bike Expedition - Venture beyond the ordinary and embark on a two-wheeled odyssey through the fabled lands of Upper Mustang, a region steeped in mystique, culture, and unparalleled beauty. Join us as we rev our engines and journey through ancient villages, rugged landscapes, and timeless traditions on this epic motorcycle tour.Hedera Hashgraph Development Company | Oodles Blockchain - We unlock the full potential of Hedera Hashgraph, a next-generation distributed ledger technology, for your business. Build lightning-fast dApps, innovative DeFi solutions, and robust NFT marketplaces with Hedera's security and scalability as your foundation. We go beyond the basics, offering expertise in decentralized identity management for enhanced privacy and user control. Our file storage solutions leverage Hedera's tamper-proof network for ultimate data security. BEST CARLIFT SERVICE NEAR ME FOR PASSENGERS - Do you have to go rapidly and advantageously? A car lift service is here to help! You can find dependable car lift services that will take you to bother-free, yet at the same, there's something else. These car lift services in car lift service near me are famous because they offer solace, security, and moderation, making them the best decision for workers. Due to the heavy traffic, driving yourself can be unpleasant and tedious.Southern Classic Landscape Management, Inc. - At Southern Classic Landscape Management, we offer the areas finest professional landscaping in Flowery Branch GA and surrounding areas. Full Address: 6164 Glen Oak Drive Flowery Branch,GA,30542The Realty Advisory - Address: 1645 Falmouth Rd, #10f, Centerville, MA 02632, USA || Phone: 508-775-6000
The LED Light - Our LED lighting specialists can help you select the right LED products for the job, large or small from retrofitting a commercial building with LEDs to a home LED cabinet lighting project, and even LED traffic safety suppliesrevit training miami - In South Florida, when it comes to finding the best CADD Solutions provider, you should choose Digital Drafting Systems, Inc. To get further details about the services provided here, you have to contact us.Laos Tour Packages - Laos tour packages are bundled with the most glamorous destinations, historical sites and lesser-known regions. Undoubtedly, you will have a chance to see the untouched nature, idyllic local life as well as cultural beauties in Laos.Birds Net Coimbatore - Totalfence.in - We at Totalfence offer you with the best quality and personally customized birds net to prevent birds from entering specific areas.Wandering the Hoi an ancient town, in 3 days - Having started our exploring in the north, experiencing the attraction and crowd of Hanoi, stunning view of Halong Bay from cruise, the charming landscape of Sapa, we next travelled towards Hoi An. Hoi An city is a beautifully and timeless preserved historic place and now it is known as a UNESCO world heritage site that you must not miss while travelling to Vietnam.
Recently Active Editors
russiankyzylnewluckasardigitalfpaacdamycritterremoval
stylondecoreudeprotectwolfpolebarnstradeportal28wicultyls
Random Editor

Tanveer
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS